863288-34-0

Product Details:

CasNo： 863288-34-0

Molecular Formula： C152H252N44O42

Purity： 99%

Synonyms: CJC1295; Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide; CJC-1295; CJC-1295 Acetate; -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl

Melting point: > 177° C (dec.)
Density: 1.45
Storage temp.: -20°C Freezer, Under inert atmosphere
Solubility: Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
Form: Solid
Color: White to Off-White

Description:
CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body's growth hormone which. Research show that after the age of 30 the body's growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.

Uses:
CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.

Benefits:
CJC1295 is a chemically synthesised peptide that significantly promotes the release of growth hormone by activating the pituitary gland. Receiving CJC-1295 peptide therapy has multiple benefits, including: increased metabolism and energy, decreased body fat and increased muscle mass, optimised immune system, improved bone density, improved sleep, shorter recovery time, repair of injuries, improved skin elasticity, reduced wrinkles, strengthened nails and hair, and more.

Pharmacology:
By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.

Clinical Use:
CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.